Trifluoroacetic Acid
Trifluoroacetic acid is a corrosive organofluorine compound that is structurally analogous to, but stronger than, acetic acid. Available in various quantities and reagent grades, it is used in NMR spectroscopy, mass spectrometry, organic synthesis, etc.
Almost 100,000-fold more acidic than acetic acid, TFA is widely used in organic chemistry. TFA is used as a reagent in organic synthesis because of its properties: volatility, organic solvent solubility, and acidic strength. It is less oxidizing than sulfuric acid and is more readily available in its anhydrous form than some other acids . Other features include:
- Used in acid-catalyzed reactions, especially peptide synthesis (to cleave esters)
- Dissolves protein when mixed with liquid SO2
- Removes t-butyl derived side-chain protecting groups in Fmoc peptide synthesis
- Can remove the t-butoxycarbonyl protecting group in organic synthesis
- At low concentrations, acts as an ion-pairing agent for peptides and small proteins in organic compound liquid chromatography
- For acid-stable materials, can be a solvent for NMR spectroscopy
- Acts as a calibrant in mass spectrometry
- Used to produce trifluoroacetate salts
- An ingredient in adhesives, sealants, paints, and coatings
When TFA combines with bases and metals, especially light metals, a strong exothermic reaction occurs. When mixed with lithium aluminum hydride (LAH), the reaction is explosive.
Although nonflammable, TFA is corrosive to skin, eyes, and mucous membranes and requires careful use and handling. It is harmful when inhaled, causes severe skin burns and eye damage, and is toxic to aquatic organisms at even low concentrations.
TFA is also a product of the metabolic breakdown of the anesthetic agent halothane. It is the suspected cause of halothane-induced hepatitis.
Medchemexpress LLC Ql9 tfa | 95.91% | 5 MG
QL9 (QLSPFPFDL) TFA is a high-affinity alloantigen for the 2C T cell receptor (TCR), intended for research use only.
- High-affinity alloantigen
- Specific for the 2C T cell receptor (TCR)
- Suitable for research applications
![Medchemexpress LLC L-Prolinamide, N,N-bis(phenylmethyl)glycyl]-4-[4-[[4-[[(phenylmethyl)amino]phosphonomethyl] | 99.9% | 1323.35 | 1 MG](https://assets.fishersci.com/TFS-Assets/CCG/product-images/5000386801-logo.png-250.jpg){kind=logo}
Medchemexpress LLC L-Prolinamide, N,N-bis(phenylmethyl)glycyl]-4-[4-[[4-[[(phenylmethyl)amino]phosphonomethyl] | 99.9% | 1323.35 | 1 MG
OncoACP3 TFA from MedChemExpress is a small-molecule ligand of prostatic acid phosphatase (ACP3). This product is applicable to research related to prostate cancer.
- Molecular formula: C62H82F3N12O15P
- Molecular weight: 1323.35
- Appearance: White to off-white solid
- Storage: Powder at -20°C for 3 years; in solvent at -80°C for 6 months, or -20°C for 1 month
- Purity (LCMS): 99.87%
Medchemexpress LLC LL-37, human TFA | 154947-66-7 | 100.0% | 4493.26 | 5 MG
LL-37, human TFA is a 37-residue, amphipathic, cathelicidin-derived antimicrobial peptide. It demonstrates a broad spectrum of antimicrobial activity.
- Exhibits broad-spectrum antimicrobial activity.
- May help protect the cornea from infection.
- Modulates wound healing.
Medchemexpress LLC Astressin 2B TFA | 99.54% | 4041.69 | 500 UG
Astressin 2B TFA is a blood-brain barrier-impermeable, highly selective CRFR2 antagonist. It blocks the protective effects mediated by CRFR2, thereby exacerbating indomethacin-induced hemorrhagic intestinal injury in rats. It also reverses the protective effects of Urocortin 1 and attenuates stress-induced anxiety-related behaviors. This product is a valuable tool for investigating the intestinal protective mechanisms of CRFR2.
- Highly selective CRFR2 antagonist (IC50=0.57 nM).
- Blood-brain barrier-impermeable.
- Exacerbates indomethacin-induced hemorrhagic intestinal injury.
- Reverses protective effects of urocortin 1.
- Attenuates stress-induced anxiety-related behaviors.
- Valuable tool for studying CRFR2 intestinal protective mechanisms.
Medchemexpress LLC D-GsMTx4 TFA | 99.89% | 4095.84 | 2 MG
D-GsMTx4 TFA is a spider peptide and the D enantiomer of GsMTx4. It inhibits the mechanosensitive ion channel Piezo2, [Ca2+]i elevation, and mTOR and PI3K-Akt signaling pathways. This peptide can be used in research related to mechanical stress, chronic pain, and idiopathic pulmonary fibrosis.
- Inhibits Piezo2-mediated mechanosensitive inward currents
- Decreases phosphorylation levels in mTOR and PI3K-Akt signaling pathways
- Inhibits mechanical stimulation-evoked [Ca2+]i increases
- Significantly inhibits mechanical allodynia and thermal hyperalgesia
Medchemexpress LLC Pardaxin P5 TFA | 67995-63-5 | ≥98% | 3381.87 | 1 MG
Pardaxin P5 TFA is the trifluoroacetate salt form of Pardaxin P5. This antimicrobial peptide is known to inhibit Escherichia coli with a MIC value of 13 μM, making it suitable for anti-infection research.
- Antimicrobial peptide
- Inhibits Escherichia coli with a MIC value of 13 μM
- TFA salt form of Pardaxin P5
- Supplied as a solid
- Specific peptide sequence: GFFALIPKIISSPLFKTLLSAVGSALSSSGDQE
- Soluble in DMSO (100 mg/mL, requires ultrasonic)
- Targets bacterial organisms and anti-infection pathways
Medchemexpress LLC OS-2966 1mg | 1mg
OS-2966 is a humanized antibody expressed in CHO cells targeting Integrin b1/ITGB1/CD29 OS-2966 carries a huIgG1 type heavy chain and a hu type light chain with a predicted molecular weight (MW) of 145 5 kDa The isotype control for OS-2966 can be referenced as Human IgG1 kappa Isotype Control (HY-P99001)
Medchemexpress LLC XStAx-VHLL TFA | 99.9% | 3231.89 | 1 MG
xStAx-VHLL TFA is a β-catenin PROTAC degrader that promotes ubiquitination and proteasome degradation of β-catenin. It inhibits the Wnt/β-catenin signaling pathway, can inhibit the proliferation of colon cancer cells, and has anti-tumor activity.
- Promotes ubiquitination and proteasome degradation of β-catenin.
- Inhibits the Wnt/β-catenin signaling pathway.
- Inhibits the proliferation of colon cancer cells.
- Exhibits anti-tumor activity in mouse intestinal tumor models.
- Induces β-catenin degradation and inhibits cell proliferation in colorectal cancer cells.
- Inhibits Wnt/β-catenin signaling in HEK293T cells.
Medchemexpress LLC PBP10 TFA | 98.2% | 1826.07 | 1 MG
PBP10 is a cell-permeable and selective gelsolin-derived peptide inhibitor of formyl peptide receptor 2 (FPR2) over FPR1. This 10-AA peptide, with rhodamine conjugated at its N-terminus, exhibits bactericidal activity against gram-positive and gram-negative bacteria and mitigates microbial-induced inflammatory effects.
- Cell-permeable
- Selective gelsolin-derived peptide inhibitor of FPR2 over FPR1
- 10-AA peptide with rhodamine conjugated at its N-terminus
- Exerts bactericidal activity against gram-positive and gram-negative bacteria
- Limits microbial-induced inflammatory effects
Medchemexpress LLC Myr-FEEERA-OH (TFA) | 990.15 | 25 MG
mP6 (Myr-FEEERA-OH) is a myristoylated peptide. It inhibits the interaction of Gα13 with integrin β3 without disrupting talin-dependent integrin function, and can block the GTP usage of Rac1, Rap1, and Rab7.
- Effectively inhibits the infection of CHO-A24 cells
- Myristoylated peptide
- Inhibits interaction of Gα13 with integrin β3
- Blocks GTP usage of Rac1, Rap1, and Rab7
Medchemexpress LLC Gln-AMS TFA | 99.85% | 588.47 | 50 MG
Gln-AMS (TFA) is a type Ia aminoacyl-tRNA synthetase (AARS) inhibitor. It specifically inhibits glutaminyl-tRNA synthetase (GlnRS) with a Ki of 1.32 μM. This product is intended for research use only.
- Inhibits glutaminyl-tRNA synthetase.
- High purity of 99.85%.
- Available in various quantities.
- Data sheet, COA, SDS, and handling instructions provided.
- Supported by customer reviews and publications.
Medchemexpress LLC Trifluoroacetic acid-13C sodium | 286425-32-9 | 98.0% | 137.00 g/mol | C13CF3NaO2 | 1mg
Trifluoroacetic acid-13C sodium is the 13C labeled isotope of Trifluoroacetic acid-13C (sodium) (HY-W754811)[1]
Medchemexpress LLC Vasculotide TFA | 99.66% | 14000 (average) | 1 MG
Vasculotide TFA is an angiopoietin-1 mimetic that activates Tie-2, inducing its phosphorylation. It exhibits anti-inflammatory and anti-permeability effects, ameliorating endotoxin-induced endothelial barrier dysfunction and promoting angiogenesis in a mouse model of diabetic ulcer. It also protects mice from vascular leakage, reduces mortality in murine abdominal sepsis, and decreases microvascular leakage while improving microcirculatory perfusion in a rat model of hemorrhagic shock.
- Activates Tie-2 and induces its phosphorylation
- Exhibits anti-inflammatory and anti-permeability effects
- Promotes angiogenesis
- Protects against vascular leakage and reduces mortality in sepsis models
- Improves microcirculatory perfusion
- For research use only
Medchemexpress LLC Α-MSH (TFA) | 171869-93-5 | 98.5% | 25 MG
α-MSH TFA (α-Melanocyte-Stimulating Hormone TFA) is an endogenous neuropeptide that acts as a melanocortin receptor 4 (MC4R) agonist. It exhibits anti-inflammatory and antipyretic activities, being a post-translational derivative of pro-opiomelanocortin (POMC).
- Modulates CNS inflammation by acting directly on melanocortin receptors in glial cells.
- Modulates NFκB activation.
- Inhibits translocation of transcription factor κB to the nucleus.
- Effectively modulates inflammatory reactions when given systemically.
Sigma Aldrich Fine Chemicals Biosciences Trifluoroacetic acid 99 fo100G
TRIFLUOROACETIC Trifluoroacetic acid 99 fo100G
